PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G06530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 155aa    MW: 16977.3 Da    PI: 12.0402
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G06530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.7e-382782358
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                      + l+cprC+stntkfCyynny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r++
  ORUFI01G06530.1 27 AEGLACPRCESTNTKFCYYNNYNLAQPRHFCKACRRYWTRGGALRNVPVGGGTRNK 82
                     56789*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-243080IPR003851Zinc finger, Dof-type
PfamPF027011.1E-323082IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4163084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MEVAEGRTVA AAAAGGGGLR GGARTEAEGL ACPRCESTNT KFCYYNNYNL AQPRHFCKAC  60
RRYWTRGGAL RNVPVGGGTR NKVAPAPCTG XCTTATSPPA SCWAPCRRRR RRRRRRRPLL  120
HRLPGRPHTR RCRTASGPWG GRTSPSRIVV VVVEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106116RRRRRRRRRRR
2108116RRRRRRRRR
3109116RRRRRRRR
4110116RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0025371e-147AP002537.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0001B06.
GenBankAP0027461e-147AP002746.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0671B11.
GenBankAP0149571e-147AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645936.18e-58PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLA0A0E0MSK01e-104A0A0E0MSK0_ORYRU; Uncharacterized protein
STRINGLOC_Os01g09720.13e-57(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-30DOF zinc finger protein 1